PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g03830.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 299aa    MW: 31751.9 Da    PI: 8.3361
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g03830.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3958117261
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Zjn_sc00022.1.g03830.1.sm.mkhc  58 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 117
                                     7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3256116IPR003851Zinc finger, Dof-type
PfamPF027013.0E-3359116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22762116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMAGAPPMHI CMDSDWFKGI VPEEPGLGSS SPSTELIVCP RQMHPAAAVA DRRLRPQHDQ  60
PLKCPRCEST HTKFCYYNNY SLSQPRYFCK TCRRYWTKGG SLRNVPVGGG CRKNKRANTK  120
KQAAAAPPLL QGHARHVAET GLHLSFSSGM QQLPPAPASV DPLSSFGLLD WNWKYDPMLA  180
GSAGGAAALD QSASSEAHFA GPGMTAGGGG ECHALSALRY AAGLGEHLQA LPPLLRSSHA  240
ENDAVDVKPA ATDRLLSLEW YGEASRAPEN AISSLGALGL WSGMFGGAHQ QHPGSSAAI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1003501e-113FP100350.1 Phyllostachys edulis cDNA clone: bphylf036a01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-149PREDICTED: uncharacterized protein LOC101759372
TrEMBLA0A0A9D8K81e-154A0A0A9D8K8_ARUDO; Uncharacterized protein
STRINGSi017962m1e-149(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.15e-38Dof family protein